PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19503A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 81aa    MW: 9169.07 Da    PI: 4.9158
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19503AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.81.4e-093574445
                               S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                               +T+ E++l  + + + G++ W++Ia +++ gRt++++  +w 
  Oropetium_20150105_19503A 35 FTEAEEDLVFRMHSLVGNR-WELIAGRIP-GRTAEEVEMFWS 74
                               9******************.*********.*******99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.2E-73179IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-83475IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-123574IPR009057Homeodomain-like
PfamPF002491.4E-83574IPR001005SANT/Myb domain
CDDcd001673.83E-73573No hitNo description
PROSITE profilePS500906.5393577IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010091Biological Processtrichome branching
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MDNSSGSQDK KSKANSRHED EAKEVNSTAE SFVDFTEAEE DLVFRMHSLV GNRWELIAGR  60
IPGRTAEEVE MFWSKKHPEK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519337e-50JF951933.1 Aegilops speltoides clone TaMYB50 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458170.16e-40hypothetical protein SORBIDRAFT_03g028170
TrEMBLC5XR426e-40C5XR42_SORBI; Putative uncharacterized protein Sb03g028170
STRINGSb03g028170.12e-39(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52753157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.13e-22CAPRICE-like MYB3